Product Name :
CD155 Recombinant Protein Swiss-Prot :
P15151 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN Restriction sites :
NdeI-XhoI Background :
Poliovirus receptor (PVR, CD155) is an immunoglobulin-like, transmembrane glycoprotein originally described as a mediator of poliovirus attachment to cells and later identified as important in adherens junction formation. Also known as nectin-like 5 (Necl-5), PVR binds nectin-3 and interacts with integrin αvβ3 and PDGFR to regulate integrin clustering and focal contact formation at the leading edge of migrating cells. Research studies demonstrate that PVR and nectin-3 regulate contact inhibition during cell motility and proliferation in transformed 3T3 cells. Additional research indicates that PVR (CD155, Necl-5) expression may play a role in invasiveness of lung adenocarcinoma. In the immune system, CD155 plays a role in natural killer (NK) cell-mediated cytotoxicity. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~36kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
CD155 Recombinant Protein Swiss-Prot :
P15151 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN Restriction sites :
NdeI-XhoI Background :
Poliovirus receptor (PVR, CD155) is an immunoglobulin-like, transmembrane glycoprotein originally described as a mediator of poliovirus attachment to cells and later identified as important in adherens junction formation. Also known as nectin-like 5 (Necl-5), PVR binds nectin-3 and interacts with integrin αvβ3 and PDGFR to regulate integrin clustering and focal contact formation at the leading edge of migrating cells. Research studies demonstrate that PVR and nectin-3 regulate contact inhibition during cell motility and proliferation in transformed 3T3 cells. Additional research indicates that PVR (CD155, Necl-5) expression may play a role in invasiveness of lung adenocarcinoma. In the immune system, CD155 plays a role in natural killer (NK) cell-mediated cytotoxicity. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~36kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
Blocking peptide available as NCP0274P

CD155 Recombinant Protein
Datasheet
COA
MSDS
SHIP