Contact us : info@bioworlde.com
Home > Product > T/B-cell surface proteins
CD158 Recombinant Protein NCP0180
Product NameCD158 Recombinant Protein
Catalog No.NCP0180
Swiss-ProtP43627
Host E.coli
TagHis-tag in C-terminal
Restriction sitesNdeI-XhoI
Background
SolublePBS, 4M Urea, PH7.4
Purification&PurityTransferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Concentration≥0.5mg/ml
Browse similar products>>
Size Price
500ug $638
1mg $1128
Add to cart My orders
Product Name :
CD158 Recombinant Protein
Swiss-Prot :
P43627
Host :
E.coli
Tag :
≥0.5mg/ml
Amino acid Sequence :
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH
Restriction sites :
NdeI-XhoI
Background :
NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory natural killer cell immunoglobulin-like receptor 2DL1, also designated KIR2DL1, CL-42, NKAT1, P58.1 or CD158a long form, is a 348 amino acid type I transmembrane protein. KIR2DL1 can bind human leukocyte antigen-C (HLA-C) via both polar and hydrophobic interactions through Met 44 in a binding pocket that coordinates Lys 80 of HLA-C.
Soluble :
PBS, 4M Urea, PH7.4
Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression vector :
pet-22b(+)
BiowMW :
~25kDa
Note :
For research use only, not for use in diagnostic procedure.
concentration :
≥0.5mg/ml
Blocking peptide available as NCP0180P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER