Contact us : info@bioworlde.com
Home > Product > Primary Antibodies
Anti-Klebsiella pneumoniae carbapenemases (KPC), Rabbit mAb MB67278
  • By using Indirect ELISA to detect the binding activity of KPC rabbit monoclonal antibody and recombinant KPC protein. Antigen concentration was 1 µ g/ml.
Product NameAnti-Klebsiella pneumoniae carbapenemases (KPC), Rabbit mAb
Catalog No.MB67278
Swiss-ProtQBC89188.1
Host 293F
ReactivityKPC-9H
ApplicationsWB ELISA
Application_allWB: 1:500~1:2000 ELISA: 1:5000~10000
BiowMW
Alternative Name
Purification&PurityThe antibody was affinity-purified by protein A and the purity is > 95% (by SDS-PAGE).
ConjugateUnconjugated
ModificationUnmodification
Browse similar products>>
Size Price
50ul $258
100ul $398
Add to cart My orders
Product Name :
Anti-Klebsiella pneumoniae carbapenemases (KPC), Rabbit mAb
Background :
Rabbit IgG1, Kappa
Product :
1mg/ml in PBS,pH7.4
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Specificity :
Using phage display technology, library of antibody was constructed from peripheral blood of New Zealand rabbits which had been immunized by KPC protein. Screening the library with recombinant KPC protein, the target antibody was obtained and then was purified by recombinant and expression.
Immunogen :
SLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQA GLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQHHHHHH
Conjugate :
Unconjugated
Modification :
Unmodification
  • By using Indirect ELISA to detect the binding activity of KPC rabbit monoclonal antibody and recombinant KPC protein. Antigen concentration was 1 µ g/ml.
Bioworld Biotech only provide peptides for our antibodies and do not provide additional peptide customization services.

Price/Size :

USD 368/1mg/vial



Tips: 

For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Describe :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (WB) and Immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or IHC performed with the neutralized antibody.

Formula:

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.

Storage:

The freeze-dried powder is more stable. For short time at 2-8°C. For long term storage store at -20°C. 


Note :

This product is for research use only (RUO only). Not for use in diagnostic or therapeutic procedures.
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER