Contact us : info@bioworlde.com
Home > Product > Primary Antibodies
TREM2 polyclonal antibody BZ17066
  • Western blot analysis of TREM2 in various cell lines lysates using TREM2 antibody.
  • Immunohistochemistry analysis of paraffin-embedded Human tonsil using TREM2 antibody.High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval.
  • Immunohistochemistry analysis of paraffin-embedded Human tonsil using TREM2 antibody.High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval.
  • Immunohistochemistry analysis of paraffin-embedded Human tonsil using TREM2 antibody.High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval.
Product NameTREM2 polyclonal antibody
Catalog No.BZ17066
Swiss-ProtQ9NZC2
Host Rabbit
ReactivityHuman,Mouse,Rat
ApplicationsWB,IHC-P,ICC/IF
Application_allWB: 1/500-1/1000 IHC: 1/50-1/100 IF: 1/50-1/200
BiowMWCalculated MW: 25 kDa; Observed MW: 25,35-50 kDa
Alternative NameTREM2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on myeloid cells 2
Purification&PurityAffinity Purified
ConjugateUnconjugated
ModificationUnmodified
Browse similar products>>
Size Price
50ul $208
100ul $358
Add to cart My orders
Product Name :
TREM2 polyclonal antibody
Background :
This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.
Product :
Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide, pH 7.3.
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Specificity :
IgG
Immunogen :
Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS
Conjugate :
Unconjugated
Modification :
Unmodified
  • Western blot analysis of TREM2 in various cell lines lysates using TREM2 antibody.
  • Immunohistochemistry analysis of paraffin-embedded Human tonsil using TREM2 antibody.High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval.
  • Immunohistochemistry analysis of paraffin-embedded Human tonsil using TREM2 antibody.High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval.
  • Immunohistochemistry analysis of paraffin-embedded Human tonsil using TREM2 antibody.High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval.
Bioworld Biotech only provide peptides for our antibodies and do not provide additional peptide customization services.

Price/Size :

USD 368/1mg/vial



Tips: 

For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Describe :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (WB) and Immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or IHC performed with the neutralized antibody.

Formula:

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.

Storage:

The freeze-dried powder is more stable. For short time at 2-8°C. For long term storage store at -20°C. 


Note :

This product is for research use only (RUO only). Not for use in diagnostic or therapeutic procedures.
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER