Recombinant :
Recombinant IL-2 R α, His, Human Source :
HEK 293 Molecular Weight :
42 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
Determined by its ability to increase the proliferation effect of IL-2 in murine CTLL-2 cells. In the presence of 1 ng/ml of recombinant IL-2, ED50 for this effect is < 1.5 µg/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
HHHHHHHHELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ LICTGEMETSQFPGEEKPQASPEGRPESETSC Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human Interleukin-2 Receptor α remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-2 Receptor α should be stable up to 1 week at 4°C or up to 3 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds to the cytokine IL-2. The IL-2R is made up of 3 subunits - alpha (α), beta (β) and gamma (γ). The α and β chains are involved in binding IL-2, while signal transduction following cytokine interaction is carried out by the γ-chain, along with the β subunit. The β and γ chains of the IL-2R are members of the type I cytokine receptor family. IL-2R has a high binding affinity to IL-2 and is expressed by antigen-activated T lymphocytes (T cells). IL-2 Rα is also known as CD25, p55, and Tac (activated T cell) antigen.Recombinant Human Interleukin-2 Receptor α (IL-2 R α), His produced in HEK 293 cells is a polypeptide chain containing 205 amino acids. A fully biologically active molecule, rhIL-2 R α has a molecular mass of 42 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Recombinant IL-2 R α, His, Human Source :
HEK 293 Molecular Weight :
42 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
Determined by its ability to increase the proliferation effect of IL-2 in murine CTLL-2 cells. In the presence of 1 ng/ml of recombinant IL-2, ED50 for this effect is < 1.5 µg/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
HHHHHHHHELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ LICTGEMETSQFPGEEKPQASPEGRPESETSC Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human Interleukin-2 Receptor α remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-2 Receptor α should be stable up to 1 week at 4°C or up to 3 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds to the cytokine IL-2. The IL-2R is made up of 3 subunits - alpha (α), beta (β) and gamma (γ). The α and β chains are involved in binding IL-2, while signal transduction following cytokine interaction is carried out by the γ-chain, along with the β subunit. The β and γ chains of the IL-2R are members of the type I cytokine receptor family. IL-2R has a high binding affinity to IL-2 and is expressed by antigen-activated T lymphocytes (T cells). IL-2 Rα is also known as CD25, p55, and Tac (activated T cell) antigen.Recombinant Human Interleukin-2 Receptor α (IL-2 R α), His produced in HEK 293 cells is a polypeptide chain containing 205 amino acids. A fully biologically active molecule, rhIL-2 R α has a molecular mass of 42 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0314-10μgP

Recombinant IL-2 R α, His, Human
Datasheet
COA
MSDS
SHIP