Recombinant : 
Recombinant Betacellulin, Human Source :
HEK 293 Molecular Weight :
15~18 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 4 pg/ml, measured in a cell proliferation assay using 3T3 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human Betacellulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Betacellulin should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum.
                                        
                    
                    
                    Recombinant Betacellulin, Human Source :
HEK 293 Molecular Weight :
15~18 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 4 pg/ml, measured in a cell proliferation assay using 3T3 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human Betacellulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Betacellulin should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum.
								
							 Blocking peptide available as BK0298-10μgP
								
                    
                
 Recombinant Betacellulin, Human
  Recombinant Betacellulin, Human   
 
                             Datasheet
Datasheet COA
COA MSDS
MSDS SHIP
SHIP