Recombinant :
Recombinant TNF R I, Human Source :
CHO Molecular Weight :
28~35 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 50 ng/ml, measured in a cell proliferation assay using 929 cells in the presence of 1 ng/ml human TNF-α. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIE N Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human TNF Receptor Type I remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TNF Receptor Type I should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-α or TNF-β to TNF-R1 initiates a signal transduction pathway that results in the activation of the transcription factor NF-κB, whose target genes are involved in the regulation of inflammatory responses, and, in certain cells, induce apoptosis. TNF-R1 is essential for proper development of lymph node germinal centers and Peyer’s patches and for combating intracellular pathogens such as Listeria. It is stored in the Golgi and translocates to the cell surface following proinflammatory stimuli.
Recombinant TNF R I, Human Source :
CHO Molecular Weight :
28~35 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 50 ng/ml, measured in a cell proliferation assay using 929 cells in the presence of 1 ng/ml human TNF-α. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIE N Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human TNF Receptor Type I remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TNF Receptor Type I should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-α or TNF-β to TNF-R1 initiates a signal transduction pathway that results in the activation of the transcription factor NF-κB, whose target genes are involved in the regulation of inflammatory responses, and, in certain cells, induce apoptosis. TNF-R1 is essential for proper development of lymph node germinal centers and Peyer’s patches and for combating intracellular pathogens such as Listeria. It is stored in the Golgi and translocates to the cell surface following proinflammatory stimuli.
Blocking peptide available as BK0287-50μgP

Recombinant TNF R I, Human
Datasheet
COA
MSDS
SHIP