Recombinant : 
Recombinant NAP-2/CXCL7, Human(CHO-expressed) Source :
CHO Molecular Weight :
9 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of human NAP-2/CXCL7 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR1 cells (human Ga15 and human CXCR1 stably expressed in CHO-K1 cells) is less than 0.1 μg/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant humanNAP-2/CXCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human NAP-2/CXCL7 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Chemokine (C-X-C motif) ligand(CXCL7) is a small cytokine belonging to the CXC chemokine family. It is an isoform of Beta-Thromboglobulin or Pro-Platelet basic protein (PPBP). CXCL7can signal through the CXCR1 and CXCR2 receptors. It is a protein that is released in large amounts from platelets following their activation. It stimulates various processes including mitogenesis, synthesis of extracellular matrix, glucose metabolism and synthesis of plasminogen activator.Recombinant human NAP-2/CXCL7 produced in CHO cells is a single polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhNAP-2/CXCL7 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
                                        
                    
                    
                    Recombinant NAP-2/CXCL7, Human(CHO-expressed) Source :
CHO Molecular Weight :
9 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of human NAP-2/CXCL7 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR1 cells (human Ga15 and human CXCR1 stably expressed in CHO-K1 cells) is less than 0.1 μg/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant humanNAP-2/CXCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human NAP-2/CXCL7 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Chemokine (C-X-C motif) ligand(CXCL7) is a small cytokine belonging to the CXC chemokine family. It is an isoform of Beta-Thromboglobulin or Pro-Platelet basic protein (PPBP). CXCL7can signal through the CXCR1 and CXCR2 receptors. It is a protein that is released in large amounts from platelets following their activation. It stimulates various processes including mitogenesis, synthesis of extracellular matrix, glucose metabolism and synthesis of plasminogen activator.Recombinant human NAP-2/CXCL7 produced in CHO cells is a single polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhNAP-2/CXCL7 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
								
							 Blocking peptide available as BK0275-1mgP
								
                    
                
 Recombinant NAP-2/CXCL7, Human(CHO-expressed)
  Recombinant NAP-2/CXCL7, Human(CHO-expressed)   
 
                             Datasheet
Datasheet COA
COA MSDS
MSDS SHIP
SHIP