Recombinant : 
Recombinant KGF/FGF-7, Human(CHO-expressed) Source :
CHO Molecular Weight :
16-18 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50 < 1 ng /ml, measured in a proliferation assay using 4MBr5 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIK GVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPM AIT Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant human Keratinocyte Growth Factor(rhKGF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Keratinocyte Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Keratinocyte Growth Factor (KGF), also known as FGF-7 and HBGF-7, is a mitogen factor belonging to the heparin-binding growth factor family. It is expressed mainly by epithelial cells. KGF binds to fibroblast growth factor receptor 2b (FGFR2b) to form a dimeric complex and initiate downstream signals. KGF plays an important role in embryonic development, cell proliferation and differentiation. It has also been reported to function in kidney and lung development, angiogenesis, wound healing and tumor invasion.
                                        
                    
                    
                    Recombinant KGF/FGF-7, Human(CHO-expressed) Source :
CHO Molecular Weight :
16-18 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50 < 1 ng /ml, measured in a proliferation assay using 4MBr5 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIK GVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPM AIT Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant human Keratinocyte Growth Factor(rhKGF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Keratinocyte Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Keratinocyte Growth Factor (KGF), also known as FGF-7 and HBGF-7, is a mitogen factor belonging to the heparin-binding growth factor family. It is expressed mainly by epithelial cells. KGF binds to fibroblast growth factor receptor 2b (FGFR2b) to form a dimeric complex and initiate downstream signals. KGF plays an important role in embryonic development, cell proliferation and differentiation. It has also been reported to function in kidney and lung development, angiogenesis, wound healing and tumor invasion.
								
							 Blocking peptide available as BK0261-5μgP
								
                    
                
 Recombinant KGF/FGF-7, Human(CHO-expressed)
  Recombinant KGF/FGF-7, Human(CHO-expressed)   
 
                             Datasheet
Datasheet COA
COA MSDS
MSDS SHIP
SHIP