Recombinant :
Recombinant DCIP-1/CXCL3, Mouse Source :
CHO Molecular Weight :
8 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of mouse DCIP-1/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/mCXCR2 cells (human Ga15 and mouse CXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Mouse DCIP-1/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse DCIP-1/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP2b. CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of cerebellum, during morphogenesis. Recombinant mouse DCIP-1/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmDCIP-1/CXCL3 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Recombinant DCIP-1/CXCL3, Mouse Source :
CHO Molecular Weight :
8 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of mouse DCIP-1/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/mCXCR2 cells (human Ga15 and mouse CXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Mouse DCIP-1/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse DCIP-1/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP2b. CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of cerebellum, during morphogenesis. Recombinant mouse DCIP-1/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmDCIP-1/CXCL3 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0192-50μgP

Recombinant DCIP-1/CXCL3, Mouse
Datasheet
COA
MSDS
SHIP