Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Human soluble CD40 Ligand (rHusCD40L) PR1113
RecombinantRecombinant Human soluble CD40 Ligand (rHusCD40L)
Catalog No.PR1113
SourceEscherichia coli.
Molecular WeightApproximately 16.3 kDa. a single non-glycosylated polypeptide chain containing 149 amino acids.
Purity>95% by SDS-PAGE and HPLC analyses.
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of IL-12 & IL-8 induction by PMB (Peripheral Mononuclear) cells was found to be <10 ng/ml, corresponding to a specific activity of >1 x 106 IU/mg.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.0.
EndotoxinLess than 1EU/mg of rHusCD40L as determined by LAL method.
Browse similar products>>
Size Price
10µg $158
50µg $298
1.0mg $enquire
Add to cart My orders
Recombinant :
Recombinant Human soluble CD40 Ligand (rHusCD40L)
Source :
Escherichia coli.
Molecular Weight :
Approximately 16.3 kDa. a single non-glycosylated polypeptide chain containing 149 amino acids.
Purity :
>95% by SDS-PAGE and HPLC analyses.
Biological Activity :
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of IL-12 & IL-8 induction by PMB (Peripheral Mononuclear) cells was found to be <10 ng/ml, corresponding to a specific activity of >1 x 106 IU/mg.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.0.
AA Sequence :
MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNL VTLENGKQLT VKRQGLYYIY AQVTFCSNRE ASSQAPFIAS LWLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL
Endotoxin :
Less than 1EU/mg of rHusCD40L as determined by LAL method.
Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Description :
CD40 ligand, CD40L (also known as CD154, TRAP or gp39), is a 261 amino acid type II transmembrane glycoprotein belonging to the TNF family, CD40L is expressed predominantly on activated CD4+ T lymphocytes, and also found in other types of cells, like NK cells, mast cells, basophils and eosinophils. Human CD40L shares 78% amino acid identity with its murine counterpart. The receptor of CD40L is CD40, a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed on B lymphocytes, monocytes, dendritic cells and thymic epithelium. Although all monomeric, dimeric and trimeric forms of soluble CD40L can bind to CD40, the trimeric form of soluble CD40L has the most potent biological activity through oligomerization of cell surface CD40, a common feature of TNF receptor family members. CD40L mediates a range of activities on B cells including induction of activation-associated surface antigen, entry into cell cycle, isotype switching and Ig secretion and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell maturation.
Blocking peptide available as PR1113P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER