Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a) PR6001
RecombinantRecombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)
Catalog No.PR6001
SourceEscherichia coli
Molecular WeightApproximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
Purity>95% by SDS-PAGE and HPLC analyses.
Biological ActivityData Not Available.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
EndotoxinLess than 1EU/mg of rHuP16 as determined by LAL method.
Browse similar products>>
Size Price
10µg $158
50µg $298
1.0mg $enquire
Add to cart My orders
Recombinant :
Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)
Source :
Escherichia coli
Molecular Weight :
Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
Purity :
>95% by SDS-PAGE and HPLC analyses.
Biological Activity :
Data Not Available.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
AA Sequence :
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYL RAAAGGTRGS NHARIDAAEG PSDIPD
Endotoxin :
Less than 1EU/mg of rHuP16 as determined by LAL method.
Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Description :
Cyclin-dependent kinase inhibitors (CDKIs) are proteins that bind to and inhibit the activity of CDKs. Two major classes of CDK inhibitors have been identified. The p16 family (p15, p16, p18 and p19) binds to and inhibits the activities of CDK4 and CDK6. The p21 family (p21, p27, p28 and p57) can bind to broad range of CDK-cyclin complexes and inhibit their activities. CDKIs are capable of suppressing growth, and several lines of evidence strongly suggest that at least some CDKIs may be tumor suppressor proteins.
Blocking peptide available as PR6001P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER