Email:shdiahds@163.com
Phone:+1-909-839-7620
Fax:+1-909-839-7620
Click here for qusetions for this product!
Product Catalog
Recombinant Human Angiostatin K1-3
| Catalogue No | Size | Format | stock | price | cart | |
| PR1001 | 1mg | None |  |
Inquire |  |
|
|
Contact information
|
||||||
Source:
Escherichia coli.
Molecular Weight:
Approximately 30.0 KDa, a single non-glycosylated polypeptide chain containing 259 amino acids.
Purity:
>95% by SDS-PAGE and HPLC analyses.
Biological Activity:
Fully biologically active when compared to standard. The activity is assayed on anti-proliferation and anti-migration of endothelial cells in vitro and anti-angiogenesis in vivo. The specific activity of anti-migration of endothelial cells in vitro is 0.55×105Units/mg.
Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:
Lyophilized from a 0.2μm filtered concentrated solution in 20mM NaAc, pH5.5, 4% mannitol.
AA Sequence:
VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP
Endotoxin:
Less than 1EU/μg of rHuAngiostatin as determined by LAL method.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage:
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage:
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Description:
Angiostatin K1-3 is a ~30 kDa fragment of plasminogen that has been shown to act as a potent inhibitor of angiogenesis and tumor growth in vitro and in vivo. Recombinant angiostatin is expressed in E. coli.