Email:shdiahds@163.com
Phone:+1-909-839-7620
Fax:+1-909-839-7620
Click here for qusetions for this product!
Product Catalog
Recombinant Human MCP-4
(rHuMCP-4/CCL13 )
Current Country :
Download PDF Datasheet
| Catalogue No | Size | Format | stock | price | cart | |
| PR1088 | 20μg | None |  |
215.20 |  |
|
|
Contact information
|
||||||
Source:
Escherichia coli.
Molecular Weight:
8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
Purity:
>96% by SDS-PAGE and HPLC analyses.
Biological Activity:
Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of ＞1 x 104 IU/mg.
Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
AA Sequence:
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Endotoxin:
Less than 1EU/mg of rHuMCP-4/CCL13 as determined by LAL method.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage:
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage:
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Description:
CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.